KHDRBS1 Peptide - middle region
KHDRBS1 Peptide - middle region
Product Specifications
Product Name Alternative
P62, p68, Sam68
UniProt
Q07666
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001258807.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LTAEIEKIQKGDSKKDDEENYLDLFSHKNMKLKERVLIPVKQYPKFNFVG
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
abx316854-01 20 µg
E3 SUMO-Protein Ligase EGR2 (EGR2) Antibody (HRP)
Sign In for Pricing
View Details abx316854-02 50 µg
E3 SUMO-Protein Ligase EGR2 (EGR2) Antibody (HRP)
Sign In for Pricing
View Details abx316854-03 100 µg
E3 SUMO-Protein Ligase EGR2 (EGR2) Antibody (HRP)
Sign In for Pricing
View Details abx316854-04 200 µg
E3 SUMO-Protein Ligase EGR2 (EGR2) Antibody (HRP)
Sign In for Pricing
View Details abx316854-05 1 mg
E3 SUMO-Protein Ligase EGR2 (EGR2) Antibody (HRP)
Sign In for Pricing
View Details