What is the catalog number for FYB1 Peptide - N-terminal region?

The catalog number for FYB1 Peptide - N-terminal region is orb1998376.

What sizes are available for FYB1 Peptide - N-terminal region?

FYB1 Peptide - N-terminal region is available in the following size(s): 100 µg.

Is FYB1 Peptide - N-terminal region in stock?

FYB1 Peptide - N-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

FYB1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

FYB, ADAP, THC3, PRO0823, SLAP130, SLAP-130

UniProt

O15117

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001230022.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QARKNLFNNQGNASPPAGPSNVPKFGSPKPPVAVKPSSEEKPDKEPKPPF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRC-D448795-25MG 25 mg

Dihydrolysergic Acid

Sign In for Pricing

View Details

A06326-Biotin 100 µg/Vial

Anti-SKA2 Antibody Picoband® (Biotine Conjugate)

Sign In for Pricing

View Details

M3893-38 200 µg

Microsomes, Male Rat Liver, Pyridine Induced

Sign In for Pricing

View Details

sc-410014-LAC 200 µL

FAM46A Lentiviral Activation Particles (h)

Sign In for Pricing

View Details

519064-01 2 mg

Insulin, Recombinant, Human (S. cerevisiae) discontinued

Sign In for Pricing

View Details

519064-02 10 mg

Insulin, Recombinant, Human (S. cerevisiae) discontinued

Sign In for Pricing

View Details