What is the catalog number for FYB1 Peptide - N-terminal region?

The catalog number for FYB1 Peptide - N-terminal region is orb1998376.

What sizes are available for FYB1 Peptide - N-terminal region?

FYB1 Peptide - N-terminal region is available in the following size(s): 100 µg.

Is FYB1 Peptide - N-terminal region in stock?

FYB1 Peptide - N-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

FYB1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

FYB, ADAP, THC3, PRO0823, SLAP130, SLAP-130

UniProt

O15117

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001230022.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QARKNLFNNQGNASPPAGPSNVPKFGSPKPPVAVKPSSEEKPDKEPKPPF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4010990.01 100 g

Fmoc-His(1-Boc)-OH

Sign In for Pricing

View Details

A07472-1-APC 100 µg/Vial

Anti-DMTF1 Antibody Picoband® APC Conjugated

Sign In for Pricing

View Details

NBP2-89596FR 0.1 mL

Rabbit Monoclonal sFRP-1 Antibody (024) [DyLight 680]

Sign In for Pricing

View Details

GB111590-100 100 μL

Anti-SIGLEC5 Rabbit pAb

Sign In for Pricing

View Details

LV777711 1.0 µg DNA

RPL21P56 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing

View Details

orb2648059-01 48 Tests

Human IFNE (Interferon epsilon) ELISA Kit

Sign In for Pricing

View Details