Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPA2 Peptide - N-terminal region

RPA2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

REPA2, RPA32, RP-A p32, RP-A p34

UniProt

P15927

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001273005.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MWNSGFESYGSSSYGGAGGYTQSPGGFGSPAPSQAEKKSRARAQHIVPCT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD16 (C16/1045), CF640R conjugate, 0.1mg/mL
BNC401045-500 1x 500 µL

CD16 (C16/1045), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TYRP1 (Tyrosinase Related Protein 1) (TA99), CF647 conjugate, 0.1mg/mL
BNC470806-100 1x 100 µL

TYRP1 (Tyrosinase Related Protein 1) (TA99), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P53 (PAb122), CF568 conjugate, 0.1mg/mL
BNC680338-100 1x 100 µL

P53 (PAb122), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Nucleolin (364-5), CF740 conjugate, 0.1mg/mL
BNC740527-500 1x 500 µL

Nucleolin (364-5), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SOX10 (Melanoma Marker) (rSOX10/1074), CF647 conjugate, 0.1mg/mL
BNC472312-500 1x 500 µL

SOX10 (Melanoma Marker) (rSOX10/1074), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
C1QA / Complement C1q A-Chain (C1QA/2955), CF740 conjugate, 0.1mg/mL
BNC742955-100 1x 100 µL

C1QA / Complement C1q A-Chain (C1QA/2955), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details