Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GCM2 Peptide - middle region

GCM2 Peptide - middle region

Product Specifications

Product Name Alternative

GCMB, hGCMb

UniProt

O75603

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_004743.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KGVHDHPRPESKSETEARRSAIKRQMASFYQPQKKRIRESEAEENQDSSG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sheep Leucine-rich alpha-2 glycoprotein 1 ELISA Kit
MBS747921-01 48 Well

Sheep Leucine-rich alpha-2 glycoprotein 1 ELISA Kit

Sign In for Pricing
View Details
Sheep Leucine-rich alpha-2 glycoprotein 1 ELISA Kit
MBS747921-02 96 Well

Sheep Leucine-rich alpha-2 glycoprotein 1 ELISA Kit

Sign In for Pricing
View Details
Sheep Leucine-rich alpha-2 glycoprotein 1 ELISA Kit
MBS747921-03 5x 96 Well

Sheep Leucine-rich alpha-2 glycoprotein 1 ELISA Kit

Sign In for Pricing
View Details
Sheep Leucine-rich alpha-2 glycoprotein 1 ELISA Kit
MBS747921-04 10x 96 Well

Sheep Leucine-rich alpha-2 glycoprotein 1 ELISA Kit

Sign In for Pricing
View Details
Desmocollin 1 + 2 Polyclonal Antibody
MBS9237990-01 0.1 mL

Desmocollin 1 + 2 Polyclonal Antibody

Sign In for Pricing
View Details
Desmocollin 1 + 2 Polyclonal Antibody
MBS9237990-02 5x 0.1 mL

Desmocollin 1 + 2 Polyclonal Antibody

Sign In for Pricing
View Details