What is the catalog number for PPARGC1B Peptide - N-terminal region?

The catalog number for PPARGC1B Peptide - N-terminal region is orb1998366.

What sizes are available for PPARGC1B Peptide - N-terminal region?

PPARGC1B Peptide - N-terminal region is available in the following size(s): 100 µg.

Is PPARGC1B Peptide - N-terminal region in stock?

PPARGC1B Peptide - N-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

PPARGC1B Peptide - N-terminal region

Product Specifications

Product Name Alternative

PERC, ERRL1, PGC1B, PGC-1 (beta)

UniProt

Q86YN6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001166169.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LSQLDASDFDSATCFGELQWCPENSETEPNQYSPDDSELFQIDSENEALL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GQB44298-01 50 mg

1- (3-Nitropyridin-2-yl) -1H-pyrazole-3-carboxylic acid

Sign In for Pricing

View Details

GQB44298-02 0.5 g

1- (3-Nitropyridin-2-yl) -1H-pyrazole-3-carboxylic acid

Sign In for Pricing

View Details

NBP2-54524MFV500 0.1 mL

Mouse Monoclonal gamma Catenin Antibody (CTNG/1664) [mFluor Violet 500 SE]

Sign In for Pricing

View Details

GWB-MS024F 50 µg

Zfp354a Antibody

Sign In for Pricing

View Details

MBS6139867-01 0.1 mL

WDR41 (WD Repeat-containing Protein 41, MSTP048) APC

Sign In for Pricing

View Details

MBS6139867-02 5x 0.1 mL

WDR41 (WD Repeat-containing Protein 41, MSTP048) APC

Sign In for Pricing

View Details