PPARGC1B Peptide - N-terminal region
PPARGC1B Peptide - N-terminal region
Product Specifications
Product Name Alternative
PERC, ERRL1, PGC1B, PGC-1 (beta)
UniProt
Q86YN6
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001166169.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LSQLDASDFDSATCFGELQWCPENSETEPNQYSPDDSELFQIDSENEALL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
P9107-19H-FITC 200 µL
PPM1E, CT (PP2C-eta, PP2CE, Protein Phosphatase 1M, Protein Phosphatase 2C Isoform eta, PPM1M) (FITC) discontinued
Sign In for Pricing
View Details 
K0591302 1.0 µg DNA
DFNB39 sgRNA CRISPR Lentivector (Human) (Target 1)
Sign In for Pricing
View Details