What is the catalog number for PTK6 Peptide - middle region?

The catalog number for PTK6 Peptide - middle region is orb1998365.

What sizes are available for PTK6 Peptide - middle region?

PTK6 Peptide - middle region is available in the following size(s): 100 µg.

Is PTK6 Peptide - middle region in stock?

PTK6 Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

PTK6 Peptide - middle region

Product Specifications

Product Name Alternative

BRK

UniProt

Q13882

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001243287.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AQSLSHGLRLAAPCRKHEPEPLPHWDDWERPREEFTLCRKLGSGYFGEVF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ELI-29687m 96 Tests

Mouse 16.5 kDa submandibular gland glycoprotein, Spt1 ELISA KIT

Sign In for Pricing

View Details

MBS3906612-01 0.01 mL

Rabbit anti-PDGFR beta Recombinant Monoclonal Antibody [BLR242L]

Sign In for Pricing

View Details

MBS3906612-02 0.1 mL

Rabbit anti-PDGFR beta Recombinant Monoclonal Antibody [BLR242L]

Sign In for Pricing

View Details

MBS3906612-03 5x 0.01 mL

Rabbit anti-PDGFR beta Recombinant Monoclonal Antibody [BLR242L]

Sign In for Pricing

View Details

MBS3906612-04 5x 0.1 mL

Rabbit anti-PDGFR beta Recombinant Monoclonal Antibody [BLR242L]

Sign In for Pricing

View Details

MBS7192268 Inquire

Rabbit anti-Caenorhabditis elegans vha-1 Polyclonal Antibody

Sign In for Pricing

View Details