PTK6 Peptide - middle region
PTK6 Peptide - middle region
Product Specifications
Product Name Alternative
BRK
UniProt
Q13882
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001243287.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: AQSLSHGLRLAAPCRKHEPEPLPHWDDWERPREEFTLCRKLGSGYFGEVF
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
057955-01 10 µg
Eukaryotic Interleukin 34 (IL34), Recombinant, Human, His-Tag
Sign In for Pricing
View Details 057955-02 50 µg
Eukaryotic Interleukin 34 (IL34), Recombinant, Human, His-Tag
Sign In for Pricing
View Details 057955-03 100 µg
Eukaryotic Interleukin 34 (IL34), Recombinant, Human, His-Tag
Sign In for Pricing
View Details 057955-04 200 µg
Eukaryotic Interleukin 34 (IL34), Recombinant, Human, His-Tag
Sign In for Pricing
View Details 
bs-12463R-Cy7 100 µL
Phospho-alpha B Crystallin (Ser59) Polyclonal Antibody, Cy7 Conjugated
Sign In for Pricing
View Details