Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SNAPIN Peptide - C-terminal region

SNAPIN Peptide - C-terminal region

Product Specifications

Product Name Alternative

BLOS7, SNAPAP, BLOC1S7

UniProt

O95295

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_036569.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LLNARRRVVLVNNILQNAQERLRRLNHSVAKETARRRAMLDSGIYPPGSP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human PDLIM3/ALP, N-Twin Strep, C-His, Flag Tag
HA210621-01 20 µg

Human PDLIM3/ALP, N-Twin Strep, C-His, Flag Tag

Sign In for Pricing
View Details
Human PDLIM3/ALP, N-Twin Strep, C-His, Flag Tag
HA210621-02 50 µg

Human PDLIM3/ALP, N-Twin Strep, C-His, Flag Tag

Sign In for Pricing
View Details
Human PDLIM3/ALP, N-Twin Strep, C-His, Flag Tag
HA210621-03 100 µg

Human PDLIM3/ALP, N-Twin Strep, C-His, Flag Tag

Sign In for Pricing
View Details
Frozen Tissue Sections, Multiple digestive system sites
CS645257 5x 5 µm

Frozen Tissue Sections, Multiple digestive system sites

Sign In for Pricing
View Details
Dystrophin Recombinant Rabbit Monoclonal Antibody [JF1-022]
ET1702-98 100 µL

Dystrophin Recombinant Rabbit Monoclonal Antibody [JF1-022]

Sign In for Pricing
View Details
Vgll1 Mouse Gene Knockout Kit (CRISPR)
KN318884LP 1 Kit

Vgll1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details