Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCNE2 Peptide - N-terminal region

CCNE2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CYCE2

UniProt

O96020

Field of Research

Cancer Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_477097.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RLQAKQQPQPSQTESPQEAQIIQAKKRKTTQDVKKRREEVTKKHQYEIRN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATP6V0E2 Protein Vector (Mouse) (pPB-C-His)
PV157434 500 ng

ATP6V0E2 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
Human ADARB2 Pre-designed siRNA Set B
SI000300B 1 Each

Human ADARB2 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Rabbit Stomatin Like Protein 2 ELISA Kit
MBS026523 Inquire

Rabbit Stomatin Like Protein 2 ELISA Kit

Sign In for Pricing
View Details
GALNS antibody
70R-13351 100 µL

GALNS antibody

Sign In for Pricing
View Details
FliP Antibody
orb815171 2 mg

FliP Antibody

Sign In for Pricing
View Details
OTS514 hydrochloride
C18012 25 mg

OTS514 hydrochloride

Sign In for Pricing
View Details