Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RASSF2 Peptide - middle region

RASSF2 Peptide - middle region

Product Specifications

Product Name Alternative

CENP-34, RASFADIN

UniProt

P50749

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_055552.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QDDNERIRPPPSSSSWHSGCNLGAQGTTLKPLTVPKVQISEVDAPPEGDQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ashless Filter Paper Discs S - 55mm
SLS2160 100 / PCK

Ashless Filter Paper Discs S - 55mm

Sign In for Pricing
View Details
Ak4 siRNA Oligos set (Mouse)
11632174 3x 5 nmol

Ak4 siRNA Oligos set (Mouse)

Sign In for Pricing
View Details
OR4A47 Human shRNA Plasmid Kit (Locus ID 403253)
TL310877 1 Kit

OR4A47 Human shRNA Plasmid Kit (Locus ID 403253)

Sign In for Pricing
View Details
Human IL-22 ELISA Kit
MBS9719280-01 48 Tests

Human IL-22 ELISA Kit

Sign In for Pricing
View Details
Human IL-22 ELISA Kit
MBS9719280-02 96 Tests

Human IL-22 ELISA Kit

Sign In for Pricing
View Details
Human IL-22 ELISA Kit
MBS9719280-03 5x 96 Tests

Human IL-22 ELISA Kit

Sign In for Pricing
View Details