Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RASSF2 Peptide - middle region

RASSF2 Peptide - middle region

Product Specifications

Product Name Alternative

CENP-34, RASFADIN

UniProt

P50749

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_055552.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QDDNERIRPPPSSSSWHSGCNLGAQGTTLKPLTVPKVQISEVDAPPEGDQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat EpCAM Antibody
V3118IHC-7ML 7 mL

Rat EpCAM Antibody

Sign In for Pricing
View Details
Rat Acaca Pre-designed siRNA Set B
SI200111B 1 Each

Rat Acaca Pre-designed siRNA Set B

Sign In for Pricing
View Details
NDUFB4 Lentiviral Activation Particles (m2)
sc-426962-LAC-2 200 µL

NDUFB4 Lentiviral Activation Particles (m2)

Sign In for Pricing
View Details
3,5-Difluorobenzoylacetonitrile
sc-506907 250 mg

3,5-Difluorobenzoylacetonitrile

Sign In for Pricing
View Details
Porcine Neuromedin U,NMU ELISA KIT
JOT-EK0430Po-01 96 Well

Porcine Neuromedin U,NMU ELISA KIT

Sign In for Pricing
View Details
Porcine Neuromedin U,NMU ELISA KIT
JOT-EK0430Po-02 48 Well

Porcine Neuromedin U,NMU ELISA KIT

Sign In for Pricing
View Details