NUP88 Peptide - middle region
NUP88 Peptide - middle region
Product Specifications
UniProt
Q99567
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001307582.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: NYGYDACAVLCLPCVPNILVIATESGMLYHCVVLEGEEEDDHTSEKSWDS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1075284-01 0.02 mg (E-Coli)
Recombinant Bacillus cereus Probable malate:quinone oxidoreductase (mqo)
Sign In for Pricing
View Details MBS1075284-02 0.02 mg (Yeast)
Recombinant Bacillus cereus Probable malate:quinone oxidoreductase (mqo)
Sign In for Pricing
View Details MBS1075284-03 0.1 mg (E-Coli)
Recombinant Bacillus cereus Probable malate:quinone oxidoreductase (mqo)
Sign In for Pricing
View Details MBS1075284-04 0.1 mg (Yeast)
Recombinant Bacillus cereus Probable malate:quinone oxidoreductase (mqo)
Sign In for Pricing
View Details MBS1075284-05 0.02 mg (Baculovirus)
Recombinant Bacillus cereus Probable malate:quinone oxidoreductase (mqo)
Sign In for Pricing
View Details MBS1075284-06 0.02 mg (Mammalian-Cell)
Recombinant Bacillus cereus Probable malate:quinone oxidoreductase (mqo)
Sign In for Pricing
View Details