Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DYRK1B Peptide - middle region

DYRK1B Peptide - middle region

Product Specifications

Product Name Alternative

MIRK, AOMS3

UniProt

Q9Y463

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_004705.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SGSSSDNRTYRYSNRYCGGPGPPITDCEMNSPQVPPSQPLRPWAGGDVPH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCDC43 (NM_144609) Human Over-expression Lysate
LS124808-20ug 20 µg

CCDC43 (NM_144609) Human Over-expression Lysate

Sign In for Pricing
View Details
1810024B03Rik sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K4834605 3x 1.0 µg

1810024B03Rik sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
ADRB2 discontinued
397880-01 50 µL

ADRB2 discontinued

Sign In for Pricing
View Details
ADRB2 discontinued
397880-02 100 µL

ADRB2 discontinued

Sign In for Pricing
View Details
Dibutyl phosphate
orb3143805-01 50 mg

Dibutyl phosphate

Sign In for Pricing
View Details
Dibutyl phosphate
orb3143805-02 10 mg

Dibutyl phosphate

Sign In for Pricing
View Details