DYRK1B Peptide - middle region
DYRK1B Peptide - middle region
Product Specifications
Product Name Alternative
MIRK, AOMS3
UniProt
Q9Y463
Field of Research
Epigenetics & Chromatin
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_004705.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: SGSSSDNRTYRYSNRYCGGPGPPITDCEMNSPQVPPSQPLRPWAGGDVPH
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
EGPS040D-10 10 µg
Recombinant Human SNRPD3/Sm-D3 protein (N-His tag)
Sign In for Pricing
View Details 
abx254930-01 96 Tests
Mouse Agouti Related Protein (AGRP) ELISA Kit
Sign In for Pricing
View Details abx254930-02 5x 96 Tests
Mouse Agouti Related Protein (AGRP) ELISA Kit
Sign In for Pricing
View Details abx254930-03 10x 96 Tests
Mouse Agouti Related Protein (AGRP) ELISA Kit
Sign In for Pricing
View Details NBP2-70559B 0.1 mL
Mouse Monoclonal GADD45 alpha Antibody (OTI1C9) [Biotin]
Sign In for Pricing
View Details 