MYO6 Peptide - C-terminal region
MYO6 Peptide - C-terminal region
Product Specifications
Product Name Alternative
DFNA22, DFNB37
UniProt
Q9UM54
Field of Research
Musculoskeletal & Connective Tissue Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001287828.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: SPQQNPAAQIPARQREIEMNRQQRFFRIPFIRPADQYKDPQSKKKGWWYA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC942956-500 1x 500 µL
C1QA / Complement C1q A-Chain (C1QA/2956), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC550856-100 1x 100 µL
WT1 (Wilm's Tumor 1) (6F-H2), CF555 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC401714-500 1x 500 µL
Cytokeratin 16 (KRT16) (Suprabasal Keratinocyte Marker) (KRT16/1714), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC402899-100 1x 100 µL
Alkaline Phosphatase (Placental) / PLAP (Germ Cell Tumor Marker) (ALPP/2899R), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940015-500 1x 500 µL
CD56 / NCAM (123C3.D5), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040009-500 1x 500 µL
MART-1 / Melan-A (M2-7C10), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details