Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TNIP2 Peptide - C-terminal region

TNIP2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

KLIP, ABIN2, FLIP1

UniProt

Q8NFZ5

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001154999.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DSREPDAGRIHAGSKTAKYLAADALELMVPGGWRPGTGSQQPEPPAEGGH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Chicken Immunoglobulin Antibody
14301-1 100 µg

Anti-Chicken Immunoglobulin Antibody

Sign In for Pricing
View Details
PZP Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV699902 1.0 µg DNA

PZP Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
NKPD1 Recombinant Protein Antigen
NBP1-93854PEP 0.1 mL

NKPD1 Recombinant Protein Antigen

Sign In for Pricing
View Details
Recombinant Mycoplasma mycoides subsp. mycoides SC Spermidine/putrescine import ATP-binding protein PotA (potA)
MBS1474340-01 0.02 mg (E-Coli)

Recombinant Mycoplasma mycoides subsp. mycoides SC Spermidine/putrescine import ATP-binding protein PotA (potA)

Sign In for Pricing
View Details
Recombinant Mycoplasma mycoides subsp. mycoides SC Spermidine/putrescine import ATP-binding protein PotA (potA)
MBS1474340-02 0.02 mg (Yeast)

Recombinant Mycoplasma mycoides subsp. mycoides SC Spermidine/putrescine import ATP-binding protein PotA (potA)

Sign In for Pricing
View Details
Recombinant Mycoplasma mycoides subsp. mycoides SC Spermidine/putrescine import ATP-binding protein PotA (potA)
MBS1474340-03 0.1 mg (E-Coli)

Recombinant Mycoplasma mycoides subsp. mycoides SC Spermidine/putrescine import ATP-binding protein PotA (potA)

Sign In for Pricing
View Details