Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TNIP2 Peptide - C-terminal region

TNIP2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

KLIP, ABIN2, FLIP1

UniProt

Q8NFZ5

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001154999.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DSREPDAGRIHAGSKTAKYLAADALELMVPGGWRPGTGSQQPEPPAEGGH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cyclin E1 Conjugated Antibody
C29030 100 µL

Cyclin E1 Conjugated Antibody

Sign In for Pricing
View Details
Human Solute Carrier Family 16, Member 3 ELISA Kit
MBS078208-01 48 Well

Human Solute Carrier Family 16, Member 3 ELISA Kit

Sign In for Pricing
View Details
Human Solute Carrier Family 16, Member 3 ELISA Kit
MBS078208-02 96 Well

Human Solute Carrier Family 16, Member 3 ELISA Kit

Sign In for Pricing
View Details
Human Solute Carrier Family 16, Member 3 ELISA Kit
MBS078208-03 5x 96 Well

Human Solute Carrier Family 16, Member 3 ELISA Kit

Sign In for Pricing
View Details
Human Solute Carrier Family 16, Member 3 ELISA Kit
MBS078208-04 10x 96 Well

Human Solute Carrier Family 16, Member 3 ELISA Kit

Sign In for Pricing
View Details
Dusp19 sgRNA CRISPR Lentivector (Mouse) (Target 3)
K3258904 1.0 µg DNA

Dusp19 sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details