Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ORC4 Peptide - C-terminal region

ORC4 Peptide - C-terminal region

Product Specifications

Product Name Alternative

ORC4L, ORC4P

UniProt

O43929

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001177808.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QKFVQRKAHSVYNFEKPVVMKAFEHLQQLELIKPMERTSGNSQREYQLMK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tim8A (T-40)
sc-101282 100 µg/mL

Tim8A (T-40)

Sign In for Pricing
View Details
Brm Peptide
DF8509-BP 1 mg

Brm Peptide

Sign In for Pricing
View Details
Rabbit Polyclonal SMURF2 Antibody [mFluor Violet 610 SE]
NBP2-81916MFV610 0.1 mL

Rabbit Polyclonal SMURF2 Antibody [mFluor Violet 610 SE]

Sign In for Pricing
View Details
GCKR Immunizing Peptide
orb59536 100 µg

GCKR Immunizing Peptide

Sign In for Pricing
View Details
Mouse Monoclonal E-Cadherin Antibody (67A4) [Alexa Fluor 532]
NBP1-42793AF532 0.1 mL

Mouse Monoclonal E-Cadherin Antibody (67A4) [Alexa Fluor 532]

Sign In for Pricing
View Details
Rabbit Polyclonal Ceruloplasmin Antibody [DyLight 550]
NBP3-05810R 0.1 mL

Rabbit Polyclonal Ceruloplasmin Antibody [DyLight 550]

Sign In for Pricing
View Details