Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ORC4 Peptide - C-terminal region

ORC4 Peptide - C-terminal region

Product Specifications

Product Name Alternative

ORC4L, ORC4P

UniProt

O43929

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001177808.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QKFVQRKAHSVYNFEKPVVMKAFEHLQQLELIKPMERTSGNSQREYQLMK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Streptococcus pneumoniae Tetracycline resistance protein tetO (tetO), partial
MBS1230058 Inquire

Recombinant Streptococcus pneumoniae Tetracycline resistance protein tetO (tetO), partial

Sign In for Pricing
View Details
BTF3 Antibody, FITC conjugated
CSB-PA01714C0Rb-01 50 µg

BTF3 Antibody, FITC conjugated

Sign In for Pricing
View Details
BTF3 Antibody, FITC conjugated
CSB-PA01714C0Rb-02 100 µg

BTF3 Antibody, FITC conjugated

Sign In for Pricing
View Details
Rat 5-Nucleotidase,5-NT ELISA KIT
E0024Ra-01 48 Well

Rat 5-Nucleotidase,5-NT ELISA KIT

Sign In for Pricing
View Details
Rat 5-Nucleotidase,5-NT ELISA KIT
E0024Ra-02 96 Well

Rat 5-Nucleotidase,5-NT ELISA KIT

Sign In for Pricing
View Details
Rat 5-Nucleotidase,5-NT ELISA KIT
E0024Ra-03 5x 96 Tests

Rat 5-Nucleotidase,5-NT ELISA KIT

Sign In for Pricing
View Details