Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DDX20 Peptide - middle region

DDX20 Peptide - middle region

Product Specifications

Product Name Alternative

DP103, GEMIN3

UniProt

Q9UHI6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_009135.4

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LEQPPNGSDTPNPEKYQESPGIQMKTRLKEGASQRAKQSRRNLPRRSSFR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Annexin A6 Antibody
8C0126-AAT 50 µg

Annexin A6 Antibody

Sign In for Pricing
View Details
Bovine Nerve Growth Factor (NGF) ELISA Kit
RDR-NGF-b-01 96 Tests

Bovine Nerve Growth Factor (NGF) ELISA Kit

Sign In for Pricing
View Details
Bovine Nerve Growth Factor (NGF) ELISA Kit
RDR-NGF-b-02 48 Tests

Bovine Nerve Growth Factor (NGF) ELISA Kit

Sign In for Pricing
View Details
CDC25A pSer76 Rabbit Polyclonal Antibody
AP02425PU-N 100 µL

CDC25A pSer76 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD4 Rabbit Polyclonal Antibody
AP20210PU-N 100 µg

CD4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
EMI1 (EMI1/1176), CF488A conjugate, 0.1mg/mL
BNC881176-100 1x 100 µL

EMI1 (EMI1/1176), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details