Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MYRIP Peptide - middle region

MYRIP Peptide - middle region

Product Specifications

Product Name Alternative

SLAC2C, SLAC2-C

UniProt

Q8NFW9

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001271352.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: WSEALSKLCPRSRALPRNPQPQPTQAQSSDQGPIAASPSSALSPNPEAMC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LNK (SH2B3) (NM_005475) Human Over-expression Lysate
LC401678 20 µg

LNK (SH2B3) (NM_005475) Human Over-expression Lysate

Sign In for Pricing
View Details
ING1 (NM_198218) Human Over-expression Lysate
LC403677 20 µg

ING1 (NM_198218) Human Over-expression Lysate

Sign In for Pricing
View Details
CD4 (C4/206), CF405M conjugate, 0.1mg/mL
BNC050206-100 1x 100 µL

CD4 (C4/206), CF405M conjugate, 0.1mg/mL

Sign In for Pricing
View Details
AsiGI, 100U
RE1126 100 U

AsiGI, 100U

Sign In for Pricing
View Details
Recombinant Human Osteocalcin/BGP protein (GST tag)
PDEH100785-01 20 µg

Recombinant Human Osteocalcin/BGP protein (GST tag)

Sign In for Pricing
View Details
Recombinant Human Osteocalcin/BGP protein (GST tag)
PDEH100785-02 100 µg

Recombinant Human Osteocalcin/BGP protein (GST tag)

Sign In for Pricing
View Details