Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MYRIP Peptide - middle region

MYRIP Peptide - middle region

Product Specifications

Product Name Alternative

SLAC2C, SLAC2-C

UniProt

Q8NFW9

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001271352.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: WSEALSKLCPRSRALPRNPQPQPTQAQSSDQGPIAASPSSALSPNPEAMC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Rat AST protein (His tag)
PDMR100007-01 20 µg

Recombinant Rat AST protein (His tag)

Sign In for Pricing
View Details
Recombinant Rat AST protein (His tag)
PDMR100007-02 100 µg

Recombinant Rat AST protein (His tag)

Sign In for Pricing
View Details
Recombinant Rat AST protein (His tag)
PDMR100007-03 500 µg

Recombinant Rat AST protein (His tag)

Sign In for Pricing
View Details
Recombinant Rat AST protein (His tag)
PDMR100007-04 1 mg

Recombinant Rat AST protein (His tag)

Sign In for Pricing
View Details
APC Anti-Human CD11a Antibody[TS1/22.1.1.13]
E-AB-F1055E-01 20 Tests

APC Anti-Human CD11a Antibody[TS1/22.1.1.13]

Sign In for Pricing
View Details
APC Anti-Human CD11a Antibody[TS1/22.1.1.13]
E-AB-F1055E-02 100 Tests

APC Anti-Human CD11a Antibody[TS1/22.1.1.13]

Sign In for Pricing
View Details