What is the catalog number for GCHFR Peptide - middle region?

The catalog number for GCHFR Peptide - middle region is orb1998338.

What sizes are available for GCHFR Peptide - middle region?

GCHFR Peptide - middle region is available in the following size(s): 100 µg.

Is GCHFR Peptide - middle region in stock?

GCHFR Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

GCHFR Peptide - middle region

Product Specifications

Product Name Alternative

P35, GFRP, HsT16933

UniProt

P30047

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_005249.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PTMVGDEQSDPELMQHLGASKRRALGNNFYEYYVDDPPRIVLDKLERRGF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HY-P81691-01 10 µL

CD226/DNAM1 Antibody (YA1436, Rabbit)

Sign In for Pricing

View Details

HY-P81691-02 50 μL

CD226/DNAM1 Antibody (YA1436, Rabbit)

Sign In for Pricing

View Details

HY-P81691-03 100 µL

CD226/DNAM1 Antibody (YA1436, Rabbit)

Sign In for Pricing

View Details

MC215075 10 µg

Ccl26 (NM_001013412) Mouse Untagged Clone

Sign In for Pricing

View Details

orb1564457-01 20 ul

[KO] PDPK1 Rabbit mAb

Sign In for Pricing

View Details

orb1564457-02 50 µL

[KO] PDPK1 Rabbit mAb

Sign In for Pricing

View Details