Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GCHFR Peptide - middle region

GCHFR Peptide - middle region

Product Specifications

Product Name Alternative

P35, GFRP, HsT16933

UniProt

P30047

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_005249.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PTMVGDEQSDPELMQHLGASKRRALGNNFYEYYVDDPPRIVLDKLERRGF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cyclin D1 Rabbit mAb
F0137-100uL 100 µL

Cyclin D1 Rabbit mAb

Sign In for Pricing
View Details
Rabbit Polyclonal PTF1A Antibody [Alexa Fluor 594]
NBP2-98726AF594 0.1 mL

Rabbit Polyclonal PTF1A Antibody [Alexa Fluor 594]

Sign In for Pricing
View Details
Phospho-MAPK15 (Thr175 + Tyr177) Rabbit pAb, PE-Cy5.5 conjugated
orb2865854 100 µL

Phospho-MAPK15 (Thr175 + Tyr177) Rabbit pAb, PE-Cy5.5 conjugated

Sign In for Pricing
View Details
MUC5AC Rabbit Polyclonal Antibody
orb3131261-01 50 µg

MUC5AC Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MUC5AC Rabbit Polyclonal Antibody
orb3131261-02 100 µg

MUC5AC Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ID3 Antibody
orb1266258 400 μl

ID3 Antibody

Sign In for Pricing
View Details