What is the catalog number for BNIP2 Peptide - C-terminal region?

The catalog number for BNIP2 Peptide - C-terminal region is orb1998337.

What sizes are available for BNIP2 Peptide - C-terminal region?

BNIP2 Peptide - C-terminal region is available in the following size(s): 100 µg.

Is BNIP2 Peptide - C-terminal region in stock?

BNIP2 Peptide - C-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

BNIP2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

NIP2, BNIP-2

UniProt

Q12982

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001307604.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ISSKFSQKIRYVFNLAELAELVPMEYVGIPECIKQVDQELNGKQDEPKNE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

V7703-100UG 100 µg

Cathepsin D Antibody

Sign In for Pricing

View Details

orb1616450 100 µL

ARL5A Conjugated Antibody

Sign In for Pricing

View Details

NBP2-73776PECY55 0.1 mL

Mouse Monoclonal RABL2A Antibody (OTI4A8) [PE/Cy5.5]

Sign In for Pricing

View Details

abx312210-01 20 µg

Pre-B Lymphocyte Protein 3 (VPREB3) Antibody (FITC)

Sign In for Pricing

View Details

abx312210-02 50 µg

Pre-B Lymphocyte Protein 3 (VPREB3) Antibody (FITC)

Sign In for Pricing

View Details

abx312210-03 100 µg

Pre-B Lymphocyte Protein 3 (VPREB3) Antibody (FITC)

Sign In for Pricing

View Details