Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BNIP2 Peptide - C-terminal region

BNIP2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

NIP2, BNIP-2

UniProt

Q12982

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001307604.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ISSKFSQKIRYVFNLAELAELVPMEYVGIPECIKQVDQELNGKQDEPKNE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

6-[ (4-Bromophenyl) sulfanyl]-3-pyridinylamine
OR303788-01 500 mg

6-[ (4-Bromophenyl) sulfanyl]-3-pyridinylamine

Sign In for Pricing
View Details
6-[ (4-Bromophenyl) sulfanyl]-3-pyridinylamine
OR303788-02 1 g

6-[ (4-Bromophenyl) sulfanyl]-3-pyridinylamine

Sign In for Pricing
View Details
Recombinant Rat Chromosome X open reading frame, human CXorf65 (Il2rg), partial
MBS9021881-01 0.02 mg (Mammalian-Cell)

Recombinant Rat Chromosome X open reading frame, human CXorf65 (Il2rg), partial

Sign In for Pricing
View Details
Recombinant Rat Chromosome X open reading frame, human CXorf65 (Il2rg), partial
MBS9021881-02 0.1 mg (Mammalian-Cell)

Recombinant Rat Chromosome X open reading frame, human CXorf65 (Il2rg), partial

Sign In for Pricing
View Details
Recombinant Rat Chromosome X open reading frame, human CXorf65 (Il2rg), partial
MBS9021881-03 1 mg (Mammalian-Cell)

Recombinant Rat Chromosome X open reading frame, human CXorf65 (Il2rg), partial

Sign In for Pricing
View Details
Recombinant Rat Chromosome X open reading frame, human CXorf65 (Il2rg), partial
MBS9021881-04 5x 1 mg (Mammalian-Cell)

Recombinant Rat Chromosome X open reading frame, human CXorf65 (Il2rg), partial

Sign In for Pricing
View Details