API5 Peptide - C-terminal region
API5 Peptide - C-terminal region
Product Specifications
Product Name Alternative
AAC11, AAC-11
UniProt
Q9BZZ5
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001136402.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LSWKPVQKVEIGQKRASEDTTSGSPPKKSSAGPKRDARQIYNPPSGKYSS
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1375493 Inquire
Recombinant Rickettsia conorii Uncharacterized protein RC0550 (RC0550), partial
Sign In for Pricing
View Details 
bs-15273R-BF680 100 µL
C7orf53 Polyclonal Antibody, AbBy Fluor™ 680 Conjugated
Sign In for Pricing
View Details abx196440 96 Tests
Human Anti-Acetylcholine Receptor Antibody (Anti-AChR) CLIA Kit
Sign In for Pricing
View Details GTR15086767 1 Vial
Lentiviral human PCYT1B shRNA (UAS) - Lentiviral human PCYT1B shRNA (UAS) plasmid
Sign In for Pricing
View Details