API5 Peptide - C-terminal region
API5 Peptide - C-terminal region
Product Specifications
Product Name Alternative
AAC11, AAC-11
UniProt
Q9BZZ5
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001136402.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LSWKPVQKVEIGQKRASEDTTSGSPPKKSSAGPKRDARQIYNPPSGKYSS
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNUM1013-50 1x 50 µL
Actin, Muscle Specific (Muscle Cell Marker) (HHF35 + MSA/953), 1mg/mL
Sign In for Pricing
View Details 
orb3088261 200 µL
Zebrafish stmn1a Rabbit Polyclonal Antibody (Fluoro647)
Sign In for Pricing
View Details FCE3288-03 2x 100 Tests
Fluor® 488 Anti-Mouse IgD Antibody[11-26c.2a]
Sign In for Pricing
View Details FAB5267JF585 0.1 mL
Mouse Monoclonal Notch-1 Antibody (N1A) [Janelia Fluor 585]
Sign In for Pricing
View Details