What is the catalog number for RANBP3 Peptide - middle region?

The catalog number for RANBP3 Peptide - middle region is orb1998333.

What sizes are available for RANBP3 Peptide - middle region?

RANBP3 Peptide - middle region is available in the following size(s): 100 µg.

Is RANBP3 Peptide - middle region in stock?

RANBP3 Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

RANBP3 Peptide - middle region

Product Specifications

UniProt

Q9H6Z4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001287794.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PFPRELAGRSAGGSSPEGGEDSDREDGNYCPPVKRERTSSLTQFPPSQSE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MBS7008178-01 0.02 mg

Recombinant Escherichia coli O17:K52:H18 Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF (arnF)

Sign In for Pricing

View Details

MBS7008178-02 0.1 mg

Recombinant Escherichia coli O17:K52:H18 Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF (arnF)

Sign In for Pricing

View Details

MBS7008178-03 5x 0.1 mg

Recombinant Escherichia coli O17:K52:H18 Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF (arnF)

Sign In for Pricing

View Details

CF800655 100 µg

CD2 Mouse Monoclonal Antibody [Clone ID: OTI1C5]

Sign In for Pricing

View Details

MBS1562899-01 0.05 mg

Recombinant Glomerella cingulata CGLO_00556 protein, N-His Tag

Sign In for Pricing

View Details

MBS1562899-02 0.1 mg

Recombinant Glomerella cingulata CGLO_00556 protein, N-His Tag

Sign In for Pricing

View Details