RANBP3 Peptide - middle region
RANBP3 Peptide - middle region
Product Specifications
UniProt
Q9H6Z4
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001287794.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: PFPRELAGRSAGGSSPEGGEDSDREDGNYCPPVKRERTSSLTQFPPSQSE
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS7259995-01 48 Well
Goat Small Nuclear Ribonucleoprotein E (SNRPE) ELISA Kit
Sign In for Pricing
View Details MBS7259995-02 96 Well
Goat Small Nuclear Ribonucleoprotein E (SNRPE) ELISA Kit
Sign In for Pricing
View Details MBS7259995-03 5x 96 Well
Goat Small Nuclear Ribonucleoprotein E (SNRPE) ELISA Kit
Sign In for Pricing
View Details MBS7259995-04 10x 96 Well
Goat Small Nuclear Ribonucleoprotein E (SNRPE) ELISA Kit
Sign In for Pricing
View Details 
MBS7194122 Inquire
Rabbit anti-Escherichia coli (strain K12) YDFE Polyclonal Antibody
Sign In for Pricing
View Details