Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

XRCC6 Peptide - C-terminal region

XRCC6 Peptide - C-terminal region

Product Specifications

Product Name Alternative

ML8, KU70, TLAA, CTC75, CTCBF, G22P1

UniProt

P12956

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001275905.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KVTKRKHDNEGSGSKRPKVEYSEEELKTHISKGTLGKFTVPMLKEACRAY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-HTRA2 (S212) Antibody
A22334-100UG 100 µg

Phospho-HTRA2 (S212) Antibody

Sign In for Pricing
View Details
ATG16L2 Antibody
E38PA4337 100 µL

ATG16L2 Antibody

Sign In for Pricing
View Details
Kuwanon K
orb3054668-01 25 mg

Kuwanon K

Sign In for Pricing
View Details
Kuwanon K
orb3054668-02 50 mg

Kuwanon K

Sign In for Pricing
View Details
Kuwanon K
orb3054668-03 100 mg

Kuwanon K

Sign In for Pricing
View Details
PAPD4-set siRNA/shRNA/RNAi Lentivector (Human)
35987091 4x 500 ng

PAPD4-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details