Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

XRCC6 Peptide - C-terminal region

XRCC6 Peptide - C-terminal region

Product Specifications

Product Name Alternative

ML8, KU70, TLAA, CTC75, CTCBF, G22P1

UniProt

P12956

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001275905.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KVTKRKHDNEGSGSKRPKVEYSEEELKTHISKGTLGKFTVPMLKEACRAY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EPPIN-WFDC6 (NM_001198986) Human Over-expression Lysate
LS100526773-100ug 100 µg

EPPIN-WFDC6 (NM_001198986) Human Over-expression Lysate

Sign In for Pricing
View Details
Anti-phospho-AKT1/2/3 (Thr308)
MBS515824-01 0.1 mg

Anti-phospho-AKT1/2/3 (Thr308)

Sign In for Pricing
View Details
Anti-phospho-AKT1/2/3 (Thr308)
MBS515824-02 5x 0.1 mg

Anti-phospho-AKT1/2/3 (Thr308)

Sign In for Pricing
View Details
HIST1H4H Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
LV702945 1.0 µg DNA

HIST1H4H Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
RAB11FIP1 (NM_025151) Human Recombinant Protein
PH37561M5 20 µg

RAB11FIP1 (NM_025151) Human Recombinant Protein

Sign In for Pricing
View Details
BAIAP2L1 AAV siRNA Pooled Vector
12998161 1.0 µg

BAIAP2L1 AAV siRNA Pooled Vector

Sign In for Pricing
View Details