Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SORBS2 Peptide - middle region

SORBS2 Peptide - middle region

Product Specifications

Product Name Alternative

ARGBP2, PRO0618

UniProt

O94875

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001139142.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PPHVPPPVPPLRPRDRSSTEKHDWDPPDRKVDTRKFRSEPRSIFEYEPGK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti Human TRIM9 Polyclonal
Y054888 100 µL

Anti Human TRIM9 Polyclonal

Sign In for Pricing
View Details
Rnf31 Mouse Gene Knockout Kit (CRISPR)
KN314948RB 1 Kit

Rnf31 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
6-Amino-2-(4-aminophenyl)benzoxazole
TRC-A581955-2.5G 2.5 g

6-Amino-2-(4-aminophenyl)benzoxazole

Sign In for Pricing
View Details
GAPDH Polyclonal Antibody
E-AB-40337-01 25 µL

GAPDH Polyclonal Antibody

Sign In for Pricing
View Details
GAPDH Polyclonal Antibody
E-AB-40337-02 100 µL

GAPDH Polyclonal Antibody

Sign In for Pricing
View Details
HOXD4 Mouse Monoclonal Antibody [Clone ID: OTI1D12]
CF809489 100 µg

HOXD4 Mouse Monoclonal Antibody [Clone ID: OTI1D12]

Sign In for Pricing
View Details