Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VRK2 Peptide - middle region

VRK2 Peptide - middle region

Product Specifications

UniProt

Q8BN21

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001123952.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: YKNPDQVYLADYGLSYRYCPNGNHKQYQENPRKGHNGTIEFTSLDAHKGV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DMAC2L (NM_001003805) Human Over-expression Lysate
LC424017 20 µg

DMAC2L (NM_001003805) Human Over-expression Lysate

Sign In for Pricing
View Details
Human PBX4 activation kit by CRISPRa
GA112952 1 Kit

Human PBX4 activation kit by CRISPRa

Sign In for Pricing
View Details
CHSY3 Human Gene Knockout Kit (CRISPR)
KN423465 1 Kit

CHSY3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue Total RNA, Jejunum
CR562866 5 µg

Tissue Total RNA, Jejunum

Sign In for Pricing
View Details
Rps13 (BC011192) Mouse Tagged ORF Clone
MG200883 10 µg

Rps13 (BC011192) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
ZNF394 antibody
FNab09694 100 µg

ZNF394 antibody

Sign In for Pricing
View Details