Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VRK2 Peptide - middle region

VRK2 Peptide - middle region

Product Specifications

UniProt

Q8BN21

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001123952.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: YKNPDQVYLADYGLSYRYCPNGNHKQYQENPRKGHNGTIEFTSLDAHKGV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ELAVL2 Polyclonal Antibody
E-AB-16548-01 20 µL

ELAVL2 Polyclonal Antibody

Sign In for Pricing
View Details
ELAVL2 Polyclonal Antibody
E-AB-16548-02 60 µL

ELAVL2 Polyclonal Antibody

Sign In for Pricing
View Details
ELAVL2 Polyclonal Antibody
E-AB-16548-03 120 µL

ELAVL2 Polyclonal Antibody

Sign In for Pricing
View Details
ELAVL2 Polyclonal Antibody
E-AB-16548-04 200 µL

ELAVL2 Polyclonal Antibody

Sign In for Pricing
View Details
HSP90AA1 Rabbit Polyclonal Antibody
TA377247 100 µL

HSP90AA1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human TCTP (TPT1) activation kit by CRISPRa
GA104961 1 Kit

Human TCTP (TPT1) activation kit by CRISPRa

Sign In for Pricing
View Details