Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HSH2D Peptide - middle region

HSH2D Peptide - middle region

Product Specifications

Product Name Alternative

ALX, HSH2

UniProt

Q96JZ2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001278203.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VISGPGTGKGSQDHSGDPTSGDRGYTDPCVATSLKSPSQPQAPKDRKVPT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

hsa-miR-3190-3p miRNA Agomir
MBS8312607-01 5 nmol

hsa-miR-3190-3p miRNA Agomir

Sign In for Pricing
View Details
hsa-miR-3190-3p miRNA Agomir
MBS8312607-02 10 nmol

hsa-miR-3190-3p miRNA Agomir

Sign In for Pricing
View Details
hsa-miR-3190-3p miRNA Agomir
MBS8312607-03 20 nmol

hsa-miR-3190-3p miRNA Agomir

Sign In for Pricing
View Details
hsa-miR-3190-3p miRNA Agomir
MBS8312607-04 5x 20 nmol

hsa-miR-3190-3p miRNA Agomir

Sign In for Pricing
View Details
MAPK8IP2 3'UTR Luciferase Stable Cell Line
TU012990 1.0 mL

MAPK8IP2 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Mouse matrix metalloproteinase 3 (MMP-3) ELISA Kit
QY-E20979 96 Tests

Mouse matrix metalloproteinase 3 (MMP-3) ELISA Kit

Sign In for Pricing
View Details