Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HSH2D Peptide - middle region

HSH2D Peptide - middle region

Product Specifications

Product Name Alternative

ALX, HSH2

UniProt

Q96JZ2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001278203.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VISGPGTGKGSQDHSGDPTSGDRGYTDPCVATSLKSPSQPQAPKDRKVPT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Asrgl1 sgRNA CRISPR Lentivector (Rat) (Target 2)
K7452103 1.0 µg DNA

Asrgl1 sgRNA CRISPR Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
GENLISA™ Human GENLISA™ Human High Sensitive Antidiuretic Hormone (ADH) ELISA
KBH1048-Hs 96 Well

GENLISA™ Human GENLISA™ Human High Sensitive Antidiuretic Hormone (ADH) ELISA

Sign In for Pricing
View Details
Cachd1 Mouse qPCR Primer Pair (NM_198037)
MP201509 200 Reactions

Cachd1 Mouse qPCR Primer Pair (NM_198037)

Sign In for Pricing
View Details
TRNAE19 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
47985111 3x 1.0 µg

TRNAE19 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Fipronil
TRC-F342200-1G 1 g

Fipronil

Sign In for Pricing
View Details
X-Ray Repair Cross Complementing 6 (XRCC6) Antibody
abx327597-01 50 µg

X-Ray Repair Cross Complementing 6 (XRCC6) Antibody

Sign In for Pricing
View Details