Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MAK16 Peptide - middle region

MAK16 Peptide - middle region

Product Specifications

Product Name Alternative

RBM13, MAK16L

UniProt

Q9BXY0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_115898.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AIEKELLERLKQDTYGDIYNFPIHAFDKALEQQEAESDSSDTEEKDDDDD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC38A11 (NM_173512) Human Tagged ORF Clone
RC216362 10 µg

SLC38A11 (NM_173512) Human Tagged ORF Clone

Sign In for Pricing
View Details
m-PEG3-S-PEG4-propargyl
MBS5771042 Inquire

m-PEG3-S-PEG4-propargyl

Sign In for Pricing
View Details
CCRL1 Antibody
G060-01 50 μL

CCRL1 Antibody

Sign In for Pricing
View Details
CCRL1 Antibody
G060-02 100 µL

CCRL1 Antibody

Sign In for Pricing
View Details
Recombinant Thermotoga maritima 2-isopropylmalate synthase (leuA), partial
MBS1406002 Inquire

Recombinant Thermotoga maritima 2-isopropylmalate synthase (leuA), partial

Sign In for Pricing
View Details
FITC Linked Monoclonal Antibody to Cytokeratin 7 (CK7)
MBS2129991-01 0.1 mL

FITC Linked Monoclonal Antibody to Cytokeratin 7 (CK7)

Sign In for Pricing
View Details