Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SYT6 Peptide - middle region

SYT6 Peptide - middle region

Product Specifications

Product Name Alternative

SytVI

UniProt

Q5T7P8

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001257734.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AGAGTSVSLLAVVVIVCGVALVAVFLFLFWKLCWMPWRNKEASSPSSANP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TLR7 Human Gene Knockout Kit (CRISPR)
KN207515LP 1 Kit

TLR7 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Topoisomerase II alpha (TOP2A) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5F8]
TA802514BM 100 µL

Topoisomerase II alpha (TOP2A) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5F8]

Sign In for Pricing
View Details
Recombinant Human ICAM-5 Protein (Fc Tag)
PDMH100323-01 20 µg

Recombinant Human ICAM-5 Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Human ICAM-5 Protein (Fc Tag)
PDMH100323-02 100 µg

Recombinant Human ICAM-5 Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Human ICAM-5 Protein (Fc Tag)
PDMH100323-03 500 µg

Recombinant Human ICAM-5 Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Human ICAM-5 Protein (Fc Tag)
PDMH100323-04 1 mg

Recombinant Human ICAM-5 Protein (Fc Tag)

Sign In for Pricing
View Details