Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SYT6 Peptide - middle region

SYT6 Peptide - middle region

Product Specifications

Product Name Alternative

SytVI

UniProt

Q5T7P8

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001257734.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AGAGTSVSLLAVVVIVCGVALVAVFLFLFWKLCWMPWRNKEASSPSSANP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human TEX13B activation kit by CRISPRa
GA111142 1 Kit

Human TEX13B activation kit by CRISPRa

Sign In for Pricing
View Details
7-Hydroxy Eliglustat
TRC-H508030-25MG 25 mg

7-Hydroxy Eliglustat

Sign In for Pricing
View Details
EverBrite TrueBlack® Hardset Mounting Medium with NucSpot® 640
#23019-T 1x 2 mL

EverBrite TrueBlack® Hardset Mounting Medium with NucSpot® 640

Sign In for Pricing
View Details
Recombinant NRG3 Antibody
RC-5021-01 50 μL

Recombinant NRG3 Antibody

Sign In for Pricing
View Details
Recombinant NRG3 Antibody
RC-5021-02 100 µL

Recombinant NRG3 Antibody

Sign In for Pricing
View Details
Recombinant NRG3 Antibody
RC-5021-03 1 mL

Recombinant NRG3 Antibody

Sign In for Pricing
View Details