Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TULP3 Peptide - middle region

TULP3 Peptide - middle region

Product Specifications

Product Name Alternative

TUBL3

UniProt

O75386

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001153880.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MSVIIPGMTLNHKQIPYQPQNNHDSLLSRWQNRTMENLVELHNKAPVWNS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IgG, Fc
I1904-62G 500 µg

IgG, Fc

Sign In for Pricing
View Details
Trans-3- (3-Chlorophenyl) -5-oxopyrrolidine-2-carboxylic acid
OR1041146-01 100 mg

Trans-3- (3-Chlorophenyl) -5-oxopyrrolidine-2-carboxylic acid

Sign In for Pricing
View Details
Trans-3- (3-Chlorophenyl) -5-oxopyrrolidine-2-carboxylic acid
OR1041146-02 250 mg

Trans-3- (3-Chlorophenyl) -5-oxopyrrolidine-2-carboxylic acid

Sign In for Pricing
View Details
Trans-3- (3-Chlorophenyl) -5-oxopyrrolidine-2-carboxylic acid
OR1041146-03 1 g

Trans-3- (3-Chlorophenyl) -5-oxopyrrolidine-2-carboxylic acid

Sign In for Pricing
View Details
Trans-3- (3-Chlorophenyl) -5-oxopyrrolidine-2-carboxylic acid
OR1041146-04 5 g

Trans-3- (3-Chlorophenyl) -5-oxopyrrolidine-2-carboxylic acid

Sign In for Pricing
View Details
Creatine kinase B-type
orb1639751-01 50 µg

Creatine kinase B-type

Sign In for Pricing
View Details