Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TULP3 Peptide - middle region

TULP3 Peptide - middle region

Product Specifications

Product Name Alternative

TUBL3

UniProt

O75386

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001153880.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MSVIIPGMTLNHKQIPYQPQNNHDSLLSRWQNRTMENLVELHNKAPVWNS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMEM61 Antibody
MBS9523195-01 0.04 mL

TMEM61 Antibody

Sign In for Pricing
View Details
TMEM61 Antibody
MBS9523195-02 0.1 mL

TMEM61 Antibody

Sign In for Pricing
View Details
TMEM61 Antibody
MBS9523195-03 0.2 mL

TMEM61 Antibody

Sign In for Pricing
View Details
TMEM61 Antibody
MBS9523195-04 5x 0.2 mL

TMEM61 Antibody

Sign In for Pricing
View Details
Mouse Caprin2 qPCR Primer Pair
QM60158S 200 Tests

Mouse Caprin2 qPCR Primer Pair

Sign In for Pricing
View Details
Recombinant Danio rerio Protein Wnt-5b (wnt5b)
MBS1372251-01 0.02 mg (E-Coli)

Recombinant Danio rerio Protein Wnt-5b (wnt5b)

Sign In for Pricing
View Details