Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SNX4 Peptide - middle region

SNX4 Peptide - middle region

Product Specifications

Product Name Alternative

ATG24B

UniProt

O95219

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_003785.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TQEGNWKETVNETGFQLKADSRLKALNATFRVKNPDKRFTDLKHYSDELQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2,4-Dibromobiphenyl
OR1092719 1 Each

2,4-Dibromobiphenyl

Sign In for Pricing
View Details
Methoxypolyethylene glycol succinimidyl succinate
orb2938863-01 250 mg

Methoxypolyethylene glycol succinimidyl succinate

Sign In for Pricing
View Details
Methoxypolyethylene glycol succinimidyl succinate
orb2938863-02 1 g

Methoxypolyethylene glycol succinimidyl succinate

Sign In for Pricing
View Details
Methoxypolyethylene glycol succinimidyl succinate
orb2938863-03 500 mg

Methoxypolyethylene glycol succinimidyl succinate

Sign In for Pricing
View Details
Mouse Arc activation kit by CRISPRa
GA200262 1 Kit

Mouse Arc activation kit by CRISPRa

Sign In for Pricing
View Details
ENPP1 Recombinant Rabbit mAb
BS49090-01 50 µL

ENPP1 Recombinant Rabbit mAb

Sign In for Pricing
View Details