Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SCNM1 Peptide - middle region

SCNM1 Peptide - middle region

Product Specifications

UniProt

Q9BWG6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001191777.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SLQLFYGKKQPGKERKQNPKHQNELRREETKAEAPLLTQTRLITQSALHR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

JM4 CRISPR/Cas9 KO Plasmid (h)
sc-407211 20 µg

JM4 CRISPR/Cas9 KO Plasmid (h)

Sign In for Pricing
View Details
T-Cell Surface Antigen CD2 (CD2) Antibody
abx111465 100 µL

T-Cell Surface Antigen CD2 (CD2) Antibody

Sign In for Pricing
View Details
TrkA Rabbit Polyclonal Antibody (PerCP-Cy5.5)
orb2553949 100 µL

TrkA Rabbit Polyclonal Antibody (PerCP-Cy5.5)

Sign In for Pricing
View Details
MGC114246 AAV siRNA Pooled Vector
28493166 1.0 µg

MGC114246 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Mouse Monoclonal SCLY Antibody (07) [Alexa Fluor 405]
NBP3-06607AF405 0.1 mL

Mouse Monoclonal SCLY Antibody (07) [Alexa Fluor 405]

Sign In for Pricing
View Details
Rabbit anti-Saccharomyces cerevisiae (strain 204508/S288c)(Baker's yeast) TOM6 Polyclonal Antibody
MBS7157122 Inquire

Rabbit anti-Saccharomyces cerevisiae (strain 204508/S288c)(Baker's yeast) TOM6 Polyclonal Antibody

Sign In for Pricing
View Details