What is the catalog number for SCNM1 Peptide - middle region?

The catalog number for SCNM1 Peptide - middle region is orb1998313.

What sizes are available for SCNM1 Peptide - middle region?

SCNM1 Peptide - middle region is available in the following size(s): 100 µg.

Is SCNM1 Peptide - middle region in stock?

SCNM1 Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

SCNM1 Peptide - middle region

Product Specifications

UniProt

Q9BWG6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001191777.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SLQLFYGKKQPGKERKQNPKHQNELRREETKAEAPLLTQTRLITQSALHR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

abx904504-01 15 nmol

Human RBM4B siRNA

Sign In for Pricing

View Details

abx904504-02 30 nmol

Human RBM4B siRNA

Sign In for Pricing

View Details

NBP3-30734JF669 0.1 mL

Mouse Monoclonal P-Selectin/CD62P Antibody (03) [Janelia Fluor 669]

Sign In for Pricing

View Details

NBP2-79564-5Plates 5 Plates

Rabbit TIM-1/KIM-1/HAVCR Antibody Pair [HRP]

Sign In for Pricing

View Details

bs-7073R-RBITC 100 µL

NME5 Polyclonal Antibody, RBITC Conjugated

Sign In for Pricing

View Details

SI010065B 1 Each

Human MVP-DT Pre-designed siRNA Set B

Sign In for Pricing

View Details