Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PADI6 Peptide - middle region

PADI6 Peptide - middle region

Product Specifications

Product Name Alternative

HPADVI, PREMBL2

UniProt

Q6TGC4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_997304.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SCILKKYRLVLHTSKEESKKARVYWPQKDNSSTFELVLGPDQHAYTLALL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Ultrasensitivity Tri-iodothyronine (u-T3) ELISA Kit
201-11-0257 96 Tests

Rat Ultrasensitivity Tri-iodothyronine (u-T3) ELISA Kit

Sign In for Pricing
View Details
PCP2 Antibody (Center) [APR33195G]
APR33195G-01 50 µL

PCP2 Antibody (Center) [APR33195G]

Sign In for Pricing
View Details
PCP2 Antibody (Center) [APR33195G]
APR33195G-02 100 µL

PCP2 Antibody (Center) [APR33195G]

Sign In for Pricing
View Details
PCP2 Antibody (Center) [APR33195G]
APR33195G-03 200 µL

PCP2 Antibody (Center) [APR33195G]

Sign In for Pricing
View Details
PCP2 Antibody (Center) [APR33195G]
APR33195G-04 400 µL

PCP2 Antibody (Center) [APR33195G]

Sign In for Pricing
View Details
Anti-Mouse BCMA Recombinant Antibody (SAA2525)
MX959013-01 50 µg

Anti-Mouse BCMA Recombinant Antibody (SAA2525)

Sign In for Pricing
View Details