Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PADI6 Peptide - middle region

PADI6 Peptide - middle region

Product Specifications

Product Name Alternative

HPADVI, PREMBL2

UniProt

Q6TGC4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_997304.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SCILKKYRLVLHTSKEESKKARVYWPQKDNSSTFELVLGPDQHAYTLALL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human BLOC1S2 Protein Lysate 20ug
IHUBLOC1S2PLLY20UG 20 µg

Human BLOC1S2 Protein Lysate 20ug

Sign In for Pricing
View Details
DNAJC2 (DnaJ Homolog Subfamily C Member 2, ZRF1, ZUO1, MPP11, MPHOSPH11) (AP)
MBS6414396-01 0.1 mL

DNAJC2 (DnaJ Homolog Subfamily C Member 2, ZRF1, ZUO1, MPP11, MPHOSPH11) (AP)

Sign In for Pricing
View Details
DNAJC2 (DnaJ Homolog Subfamily C Member 2, ZRF1, ZUO1, MPP11, MPHOSPH11) (AP)
MBS6414396-02 5x 0.1 mL

DNAJC2 (DnaJ Homolog Subfamily C Member 2, ZRF1, ZUO1, MPP11, MPHOSPH11) (AP)

Sign In for Pricing
View Details
Fibrinogen beta Chain Mouse mAb
orb2717545-01 50 µL

Fibrinogen beta Chain Mouse mAb

Sign In for Pricing
View Details
Fibrinogen beta Chain Mouse mAb
orb2717545-02 100 µL

Fibrinogen beta Chain Mouse mAb

Sign In for Pricing
View Details
Oz Biosciences Combimag 200 ul
CM20200 1 Each

Oz Biosciences Combimag 200 ul

Sign In for Pricing
View Details