Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EWSR1 Peptide - middle region

EWSR1 Peptide - middle region

Product Specifications

Product Name Alternative

EWS, EWS-FLI1, bK984G1.4

UniProt

Q01844

Field of Research

Cancer Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001156757.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QSSFRQDHPSSMGVYGQESGGFSGPGENRSMSGPDNRGRGRGGFDRGGMS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mucin 5AC (MUC5AC) (45M1), CF740 conjugate, 0.1mg/mL
BNC740031-100 1x 100 µL

Mucin 5AC (MUC5AC) (45M1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Frozen Tissue Sections, Breast
CS641713 5x 5 µm

Frozen Tissue Sections, Breast

Sign In for Pricing
View Details
rac-2-(2-Chlorophenyl)-(6,7-dihydro-4H-thieno[3,2-c]pyridin-5-yl)acetonitrile
TRC-C379515-500MG 500 mg

rac-2-(2-Chlorophenyl)-(6,7-dihydro-4H-thieno[3,2-c]pyridin-5-yl)acetonitrile

Sign In for Pricing
View Details
Linagliptin
TRC-L465900-500MG 500 mg

Linagliptin

Sign In for Pricing
View Details
ProteoSpin Abundant Serum Protein Depletion Kit
17300 25 Preparations

ProteoSpin Abundant Serum Protein Depletion Kit

Sign In for Pricing
View Details
FOXP4 (NM_001012426) Human Over-expression Lysate
LY422862 100 µg

FOXP4 (NM_001012426) Human Over-expression Lysate

Sign In for Pricing
View Details